Vraag Het CORONA-virus. Nieuwtjes en UPDATES

Meer
2 weken 1 dag geleden #56013 door katertje
Meerdere Nederlandse militairen in Litouwen besmet met coronavirus. Afgelopen nacht vijf soldaten door luchtmacht opgehaald.

Meer Nederlandse militairen die op uitzending zijn in Litouwen zijn besmet met het coronavirus. Maandag was er nog sprake van één militair, maar inmiddels gaat het om “enkele” militairen, laat minister Ank Bijleveld van Defensie aan de Tweede Kamer weten.

De gehele kazerne is inmiddels tot quarantainegebied verklaard. De afgelopen nacht zijn vijf Nederlandse militairen hier door de luchtmacht opgehaald. Een van hen was besmet en is opgenomen in het ziekenhuis in Utrecht. De andere vier zitten in quarantaine.

Verder heeft ook een Nederlandse waarnemer bij de United Nations Truce Supervision Organization (UNTSO) het coronavirus opgelopen. De militair heeft geen klachten. De UNTSO ziet toe op de wapenstilstand tussen Israël en Arabische landen.
De volgende gebruiker (s) zei dank u: dirko

Please Inloggen to join the conversation.

Meer
2 weken 4 dagen geleden #56007 door katertje
Plotseling was het daar, als een dief in de nacht, het Coronavirus dat Europa lam legt, plotseling? Toevallig? Een biowapen? We weten het niet, feit is dat het al geoefend was in oktober 2019 door de NWO (Nieuwe Wereld Orde) en nu tot uitvoering wordt gebracht.

Event 201-oefening
Event 201 was een 3,5 uur durende pandemische oefening die een reeks dramatische, op scenario’s gebaseerde, gefaciliteerde discussies simuleerde (nu in uitvoering maart 2020), waarbij levensechte dilemma’s werden gesimuleerd die verband zouden houden met de reactie op een hypothetische, maar wetenschappelijk plausibele pandemie. Vijftien wereldwijde leiders van het bedrijfsleven, de overheid en de volksgezondheid waren spelers in de simulatieoefening die onopgelost beleid en economische kwesties belichtten die nu en in de toekomst met voldoende politieke wil, financiële investeringen en aandacht kunnen worden opgelost.
De oefening bestond uit vooraf opgenomen nieuwsuitzendingen, live “personeels” -briefings en gemodereerde discussies over specifieke onderwerpen. Deze problemen zijn zorgvuldig ontworpen in een meeslepend verhaal dat de deelnemers en het publiek heeft opgeleid.
Het Johns Hopkins Center for Health Security, het World Economic Forum en de Bill & Melinda Gates Foundation waren de sponsors en initiefnemers van deze oefening

Evenement 201
Het Johns Hopkins Bloomberg Center for Health Security, in samenwerking met het World Economic Forum en de Bill and Melinda Gates Foundation, organiseerde Event 201, een pandemische oefening op hoog niveau op 18 oktober 2019 in New York, NY. De oefening illustreerde gebieden waar publiek-private partnerschappen nodig zullen zijn tijdens de reactie op een ernstige pandemie om de grootschalige economische en maatschappelijke gevolgen te verminderen.

Statement over nCoV (COVID-19) en de pandemische oefening 18 October 2019
“In de afgelopen jaren heeft de wereld een groeiend aantal epidemische gebeurtenissen meegemaakt, wat neerkomt op ongeveer 200 per jaar. Deze gebeurtenissen nemen toe en verstoren de gezondheid, de economie en de samenleving. Het beheer van deze gebeurtenissen belast de wereldwijde capaciteit, een pandemische dreiging. Deskundigen zijn het erover eens dat het slechts een kwestie van tijd is voordat een van deze epidemieën wereldwijd wordt: een pandemie met potentieel catastrofale gevolgen. Een ernstige pandemie, die “Event 201″ genoemd wordt, vereist betrouwbare samenwerking tussen verschillende industrieën, nationale regeringen en belangrijke internationale instellingen”.
Deze sessies werden opgenomen en hier te zien in vijf video’s.

Aanbevelingen
De volgende ernstige pandemie zal niet alleen leiden tot grote ziekte en levensverlies, maar kan ook leiden tot grote cascades van economische en maatschappelijke gevolgen die een grote bijdrage kunnen leveren aan de wereldwijde impact en het lijden. De pandemie-oefening Event 201, die op 18 oktober 2019 werd gehouden, toonde een aantal van deze belangrijke hiaten in de voorbereiding op de pandemie, evenals enkele elementen van de oplossingen tussen de publieke en de private sector die nodig zullen zijn om deze op te vullen. Het Johns Hopkins Center for Health Security, het World Economic Forum en de Bill & Melinda Gates Foundation stelden gezamenlijk deze aanbevelingen voor.
Boven genoemde organisaties behoren tot de NWO, de schaduwregering van de VS en de wereld die de media, farmaceutische industrie in handen hebben. Bloomberg en Bill Gates zijn de rijkste mannen ter wereld.

oneworld.press/?module=articles&action=view&id=1360
De volgende gebruiker (s) zei dank u: dirko

Please Inloggen to join the conversation.

Meer
2 weken 4 dagen geleden - 2 weken 4 dagen geleden #56004 door katertje
U had van mij nog de reactie tegoed van Graaf Lippens, al een jaar of 40 de burgemeester van buurgemeente Knokke-Heist. Werd wakker gemaakt met zijn tirade eergisteren op Omroep Zeeland. Zijn optreden wordt elke nieuwsuitzending op tv van Omroep Zeeland herhaald....Komt ie...

Belgische buurgemeente weert Nederlanders ;
'Jullie maatregelen zijn belachelijk!'
Burgemeester Leopold Lippens van Knokke-Heist, waar Nederlanders sinds vandaag geweerd worden vanwege het coronavirus, maakt zich kwaad over de lakse houding van Nederland.

"Nederlanders hebben er een handje van om te zeggen dat zij de beste zijn, de rijkste, de slimste. Maar wat Nederland nu doet is onaanvaardbaar! Uw regering is een stelletje onnozelaars!", zei hij vanmorgen op de radio.

Hij vindt dat de Nederlandse overheid weinig maatregelen neemt om de verspreiding van het coronavirus tegen te gaan. "Dit is belachelijk! Uw land heeft altijd de mond vol over dat u het zo goed voor elkaar heeft, maar de maatregelen in Nederland zijn een lachertje!"


Lippens pleit voor een zogeheten lockdown in Nederland, net als in België en meerdere andere Europese landen. Zolang dat niet het geval is, zijn we wat hem betreft in zijn gemeente niet meer welkom. En dus ook niet in het ziekenhuis AZ Zeno, waar normaal gesproken ook weleens Zeeuws-Vlaamse patiënten heen gaan.

"Ik zit niet te wachten op Nederlanders die hierheen komen en lopen te snoeven dat het in Nederland wel mee zal vallen. Dit is een internationaal virus en vereist een internationale aanpak. En dan moet je niet zoals in Nederland alles maar openhouden!", zei Lippens in het radioprogramma Zeeland wordt wakker.


Nederlanders die worden aangetroffen in de gemeente, bijvoorbeeld nadat ze zijn herkend aan hun nummerbord, moeten aantonen dat ze er zijn voor legitieme redenen, zoals voor hun werk. Zo niet dan krijgen ze volgens Lippens een boete. Een bezoek aan het ziekenhuis in Knokke is geen geldige reden, benadrukt hij. "Ik wil de Belgen verdedigen tegen de idioterie van Nederland", herhaalt hij.

De gemeente Knokke-Heist grenst aan Sluis, waar eerder juist maatregelen werden genomen om Belgen te weren. De Nederlandse maatregelen waren nodig omdat veel Belgen de grens over gingen nadat bij onze zuiderburen de cafés en restaurants dicht moesten, terwijl ze hier nog open waren. En later gebeurde hetzelfde met de winkels. In Nederland zijn de winkels nu nog altijd geopend. Cafés en restaurants zijn hier inmiddels ook dicht.
'Idioten'
Burgemeester Lippens noemt zijn de landgenoten die de grens over gaan 'idioten'. "Dat is echt levensgevaarlijk!", zegt hij. "Die mensen hebben geen burgerzin en zouden wat mij betreft een zware boete moeten krijgen." Volgens Lippens heeft de gemeente Sluis ook hulp gevraagd van de Belgische politie, om de grens beter te controleren.

In een reactie op Twitter ontkent burgemeester Marga Vermue van de Zeeuwse buurgemeente Sluis dat het ziekenhuis Zeeuwse patiënten weigert. "Alle patiënten, waar dan ook vandaan, blijven welkom in het ziekenhuis", schrijft ze na een gesprek met de directeur van het ziekenhuis.

> Opmerkelijk overigens dat asielzoekers gewoon mogen blijven komen en geen strobreed in de weg wordt gelegd. Zouden die immuun zijn?
Laatst bewerkt: 2 weken 4 dagen geleden door katertje.

Please Inloggen to join the conversation.

  • dirko
  • dirko's Profielfoto
  • Offline
  • Spammer
  • Spammer
  • Als iets niet kan, kan het tóch. Overste Ranft.
Meer
2 weken 4 dagen geleden #56003 door dirko
..
Wat velen allang dachten..:

www.rd.nl/opinie/lakse-overheden-oorzaak-coronacrisis-1.1643440

Het is al twintig jaar algemeen bekend dat een nieuwe stam van het coronavirus vroeg of laat een pandemie zou gaan veroorzaken. De huidige coronacrisis was te voorzien en ze werd al jarenlang verwacht. Waarom werd er dan geen actie ondernomen door regeringen en het WHO?

Coronavirussen zijn bekende luchtwegvirussen. Ze zijn de oorzaak van de meeste verkoudheden. In het algemeen zijn ze niet dodelijk. Toch kunnen ze ontsporen en een gevaar voor de volksgezondheid gaan vormen. De stam SARS-CoV was de eerste die ontspoorde en een bedreiging werd. Tijdens mijn bezoek in 2003 aan een congres van longspecialisten in Australië was er speciale aandacht voor SARS-CoV, dat destijds een ernstig ademhalingssyndroom (SARS) veroorzaakte. SARS had een sterftecijfer van 9 procent en werd gezien als een serieus gevaar voor de westerse samenleving. Gelukkig was SARS niet zo besmettelijk als gevreesd. Binnen enkele maanden was het virus verdwenen. Toch wist elke longspecialist dat dit niet het laatste dodelijke coronavirus zou zijn.

In 2012 stak het volgende coronavirus, MERS-CoV, de kop op. Met een sterftecijfer van boven de 30 procent was dit het meest agressieve coronavirus tot nu toe. Ook dit virus verdween weer zonder een pandemie te veroorzaken. Opnieuw wisten longspecialisten dat dit ook niet het laatste dodelijke coronavirus zou zijn.

Sinds 2019 is er het SARS-CoV2, het coronavirus dat Covid-19 veroorzaakt. Het heeft de pandemie veroorzaakt waar destijds iedereen bang voor was. Met een sterftecijfer van gemiddeld 3 tot 4 procent is SARS-CoV2 niet zo dodelijk als eerdere coronavirussen, maar wel veel besmettelijker. Daarom is het gevaarlijk voor de zwaksten van onze samenleving.

RNA-virus
Coronavirussen zijn RNA-virussen. Ze vinden hun oorsprong in het genoom van hogere organismen. Nieuwe stammen ontstaan voortdurend door recombinatie van RNA. Momenteel kennen we zeven soorten die de mens kunnen infecteren. Bij besmetting ontwikkelt de mens luchtweginfectiesademhalingssymptomen van verschillende ernst. Twee types, HCoV-229E en HCoV-OC43, veroorzaken verkoudheid. De andere coronavirussen kunnen leiden tot ernstigere luchtweginfecties en kunnen zelfs dodelijk zijn.

Tussen de uitbraak van SARS in 2003 en de uitbraak van Covid-19 ligt zeventien jaar. In deze jaren zagen Facebook, Snapchat en Amazon het licht. Virtual Reality, kunstmatige intelligentie en ”machine learning” werden ontwikkeld. Het menselijk DNA werd in kaart gebracht, evenals het genoom van meer dan 250 andere organismen. De genomen van honderden virussen, waaronder alle coronavirussen, werden eveneens ontrafeld en in kaart gebracht. Bovendien werd de genbewerkingstechnologie CRISPR-Cas ontwikkeld.

In zeventien jaar tijd zijn veel hightech-gadgets en technologieën ontwikkeld. Maar waar bleef in deze jaren een adequate behandeling tegen coronavirussen? Is er een vaccin ontwikkeld? Of een antilichaam? Alle kennis om dat te doen was aanwezig. En we wisten dat er een nieuwe uitbraak van het coronavirus zou komen, waarschijnlijk in China. Het schokkende feit is dat er niets is ontwikkeld om de volgende uitbraak van een dodelijk coronavirus te bestrijden. Helemaal niets!

Duizenden mensen stierven tijdens de corona-epidemieën van 2003 en 2013, omdat er verrassend genoeg geen vaccin, behandeling of diagnose was ontwikkeld. Anno 2020 doodt een coronavirus opnieuw duizenden mensen. Zeker, er is nu een diagnostische test beschikbaar. Maar een vaccin of behandeling is er nog steeds niet.

Het is bijna ongelooflijk. We kunnen ons echt afvragen waarom onze regeringen, onder leiding van de WHO, geen onderzoeks- en ontwikkelingsprogramma hebben opgezet om voorbereid te zijn op deze uitbraak. Dat zou geen grote wetenschappelijke opgave zijn geweest, en ook niet erg kostbaar.

Eiwitten
Alle dodelijke coronavirussen hebben zeer vergelijkbare moleculaire structuren. Hun virale genoom codeert voor verschillende eiwitten met unieke functies, waaronder een N-eiwit en een spike (S)-eiwit. Het N-eiwit, dat in alle agressieve coronastammen voorkomt, wordt momenteel gebruikt als een diagnostische ”marker”. Het S-eiwit is het beste doelwit bij de ontwikkeling van vaccins en virus-remmende antistoffen, omdat het S-eiwit nodig is om de cellen van het menselijk lichaam binnen te dringen.

Nieuwe studies hebben aangetoond dat Covid-19 dezelfde ACE2-receptor gebruikt om menselijke cellen te infecteren als het SARS-virus van 2003. Een op ACE2 gebaseerde behandeling voor SARS zou dus een behandeling voor Covid-19 zijn geweest. Tenminste, als die zou zijn ontwikkeld.

Onaangenaam
Net als SARS en MERS is Covid-19 een onaangename wake-up call voor onze slapende regeringen. Die hadden al lang geleden hun verantwoordelijkheid moeten nemen. Er was immers volop gelegenheid om behandelingen en vaccins te ontwikkelen om de Corona-crisis, die in feite zeventien jaar geleden is begonnen, te voorkomen.

Als ze naar coronadeskundigen hadden geluisterd, was er nu een oplossing geweest. Als ze enkele miljoenen hadden besteed aan preventief en curatief onderzoek, zou de wereld voorbereid zijn geweest op de coronacrisis. Sterker nog, er zou geen coronacrisis zijn geweest. Kennelijk hebben onze overheden ervoor gekozen om de ogen hiervoor te sluiten en het leven van duizenden mensen op het spel te zetten. Ze nemen zelfs het faillissement van het economische systeem op de koop toe. Maar het leven van de slachtoffers kan niet met geld worden vergoed.

De auteur werkte twintig jaar als moleculair bioloog aan luchtwegziekten en is auteur van ”Terug naar de Oorsprong” (2009) en ”Darwin Revisited” (2018).

...

De draad geheel kwijt. Soms Bang, maar altijd Olufsen.!!
De volgende gebruiker (s) zei dank u: katertje

Please Inloggen to join the conversation.

Meer
2 weken 5 dagen geleden #56000 door katertje
In Duitsland en Oostenrijk verstrekt de grootste gsm-operator van elk land de autoriteiten nu gebruikersgegevens zoals locatie-informatie – onder verwijzing naar de Coronapandemie.

Sveriges Radio radio meldt dat het Robert Koch-instituut – dat wil zeggen de Duitse federale overheidsinstantie en onderzoeksinstituut dat verantwoordelijk is voor ziektebestrijding en preventie – nu gegevens over de locatiegegevens van telefoons krijgt toegewezen door het telecommunicatiebedrijf Deutsche Telekom. Het is de bedoeling dat de overheidsinstantie voor infectiebescherming kan beoordelen of mensen de oproep tot quarantaine volgen.

Op dinsdagavond heeft de Deutsche Telekom vijf gigabyte aan informatie geleverd over hoe de klanten van het bedrijf met hun mobiele telefoon zich verplaatsen. De informatie, die naar verluidt is geanonimiseerd, zou het mogelijk moeten maken om in de hele Bondsrepubliek te traceren.

Het hoofd van het Robert Koch-instituut, Lothar Wiele, stelt dat het doel van de monitoring is om te kunnen vaststellen “of de bewegingen van mensen in de samenleving afnemen”.
“Als we kunnen zien dat mensen zich blijven bewegen en de verspreiding van de infectie tegelijkertijd doorgaat, dan weten we waarom”, zegt hij.
Soortgelijke maatregelen worden ook genomen in Oostenrijk, waar het telecommunicatiebedrijf A1 nu informatie verstrekt aan de Oostenrijkse autoriteiten. Deze autoriteiten hebben strenge regels voor quarantaine aangekondigd en iedereen die deze regels illegaal overtreedt, kan een boete krijgen. De manager van A1 had er echter voor moeten zorgen dat de gegevens die het bedrijf aan de autoriteiten verstrekt, geen identificatie van personen mogelijk maken.

In Duitsland hebben de autoriteiten zich tot nu toe tevreden gesteld met het adviseren van mensen om de socialisatie tot een minimum te beperken. Echter, op woensdagavond gaf Merkel een toespraak tot de republiek waarin ze aankondigde dat er ook in Duitsland strengere gedragsregels te verwachten zijn.

In haar toespraak tot het Duitse volk zei Merkel onder andere dat Duitsland nu het risiconiveau naar het volgende hoogste niveau tilt, dat er reisverboden zullen worden ingevoerd, dat er snel nieuwe specialistische ziekenhuizen in Berlijn zullen worden gebouwd en dat de corona-crisis “onze grootste uitdaging sinds de Tweede Wereldoorlog is”.

Merkel verklaarde ook dat wijzelf het belangrijkste instrument zijn in de strijd tegen het virus en ze deed een beroep op het verantwoordelijkheidsgevoel van de Duitsers:
“Ik ben ervan overtuigd dat we deze taak aankunnen als alle burgers het echt als hun persoonlijke taak zien.”
Merkel heeft echter niets gezegd over het feit dat de Duitse autoriteiten nu technische hulpmiddelen gebruiken om ervoor te zorgen dat de burgers verantwoordelijkheidsgevoel tonen.

> Voorbereidingen voor totale controle ! De oorlog op de eigen bevolking is geopend.

Please Inloggen to join the conversation.

Meer
2 weken 5 dagen geleden #55999 door katertje
Kamervragen van Wilders PVV aan Min.Pres. en de Min van VWS over de capaciteit van IC-units en beademingsapparaten in Nederland i.v.m. de Corona-pandemie

Bijlagen:

Please Inloggen to join the conversation.

Meer
2 weken 5 dagen geleden #55993 door katertje
Rutte sorteert voor op een vierde kabinet Rutte met de PvdA (en de communicerende holle vaten GroenLinks en D66)

Oud-staatssecretaris Martin van Rijn van de PvdA wordt de nieuwe minister voor Medische Zorg, heeft premier Rutte zojuist bekendgemaakt. Het is voor drie maanden en op verzoek van het kabinet, zegt Rutte. Van Rijn treedt op persoonlijke titel toe tot het kabinet.

Hij volgt VVD'er Bruno Bruins op, die gisteren ontslag nam vanwege ernstige oververmoeidheid. Rutte is blij dat Van Rijn ja heeft gezegd "omdat hij meteen beschikbaar is en ik enorm veel vertrouwen in hem heb".

Van Rijn is goed ingevoerd in de zorgsector. Hij is nu voorzitter van de raad van bestuur van de Reinier Hagagroep, met ziekenhuizen in Den Haag, Delft en Zoetermeer. In het kabinet-Rutte II was hij samen met minister Schippers verantwoordelijk voor grote veranderingen en bezuinigingen in de zorg.
Zo loodste hij de Wet langdurige zorg en een nieuwe Wet maatschappelijke ondersteuning door het parlement.
Rutte reageerde geïrriteerd op vragen van een journalist over het beleid van Van Rijn in het vorige kabinet als PvdA-staatssecretaris van Volksgezondheid.

Het is de afgelopen decennia niet voorgekomen dat een voormalige bewindspersoon van een oppositiepartij lid werd van een kabinet. Rutte: "Deze crisis is zo groot, partijkleur maakt nu even niet uit."

PvdA-leider Asscher denkt er ook zo over. "Als er een nationale crisis is dan help je waar je kan. Ik ben trots op iedereen die in deze moeilijke tijd naar voren stapt. Veel succes, Martin van Rijn."
Ook de VVD-fractie reageert positief. Fractievoorzitter Dijkhoff: "In deze tijd van crisis is er geen tijd om in te werken. Martin heeft de kennis en ervaring op VWS om direct bij te dragen aan het onder controle houden van het coronavirus."

> Van Rijn heeft zich onder Rutte laten verleiden tot het voeren van een beleid dat zéér nadelig is geweest voor de hele zorgsector - wat overigens door de trouwe PvdA-stemmers keihard is afgestraft .Zijn WMO is uitgedraaid op een regelrechte ramp en voor de Jeugdwet geldt hetzelfde. Maar die nachtmerrie raakt alleen de mensen die van deze wetten afhankelijk zijn. De rest heeft geen idéé. Voor de schatkist zijn deze wetten een zegen.
Het hoofdpijn ministerie gaat dus naar “de vijand”. Slim bekeken.
Overigens zei Rutte dat hij een van de beste krachten was in zijn kabinet. Dat zegt genoeg toch! We wachten af!

Please Inloggen to join the conversation.

Meer
2 weken 5 dagen geleden - 2 weken 5 dagen geleden #55992 door katertje
Brabantse ziekenhuizen slaan alarm: 'Elke drie dagen verdubbelt aantal patiënten'

Ziekenhuizen in de provincie Noord-Brabant vrezen de stroom aan coronapatiënten over één tot twee weken niet meer aan te kunnen. Ze doen daarom een dringend beroep op ziekenhuizen in de rest van ons land om patiënten over te nemen. "De situatie is echt zorgelijk", zeggen ziekenhuisdirecteuren.

In totaal hebben de Brabantse ziekenhuizen 120 intensive care-plekken. Die hopen ze snel tot 300 uit te breiden. Maar zelfs als dat lukt, is de vrees groot dat de stroom patiënten zo hard toeneemt dat de ziekenhuizen het straks niet meer aankunnen, waarschuwen Brabantse ziekenhuisdirecteuren.
Er liggen nu landelijk 281 mensen op de ic. Gisteren waren dat er nog 210.

Speciale tent
Bij het ziekenhuis in Uden wordt een speciale tent opgebouwd waar 20 bedden inkomen. Dat moet de druk op de Eerste Hulp verlichten. Er worden ook andere maatregelen genomen: zo wordt de reguliere zorg volledig opgeofferd aan coronabehandelingen. Dat gebeurt ook in andere Brabantse ziekenhuizen.
Ook worden patiënten verplaatst. "Als we nu niet kunnen uitplaatsen, ligt het binnen 48 uur helemaal vol", zegt de ziekenhuisdirecteur.

Echt zorgelijk
Ook in het Elisabeth Tweedstedenziekenhuis in Tilburg is de reguliere zorg enorm teruggebracht. "Ziekenhuizen tot in Zwolle en Leeuwarden bieden ons hulp aan", zegt Bart Berden van het ziekenhuis.
De ziekenhuisdirecteur is duidelijk: "Als je de situatie in Brabant bekijkt, is het echt zorgelijk."
Laatst bewerkt: 2 weken 5 dagen geleden door katertje.
De volgende gebruiker (s) zei dank u: dirko

Please Inloggen to join the conversation.

Meer
2 weken 6 dagen geleden - 2 weken 4 dagen geleden #55990 door katertje


In het debat afgelopen woensdag vlogen harde verwijten over en weer over de gekozen aanpak, die minder ver gaat dan in menig ander Europees land. Op basis van dat advies zei Rutte in zijn tv-toespraak van afgelopen maandag, dat het land niet op slot zal gaan en het kabinet kiest voor een scenario van beheerste verspreiding...die fasering is cruciaal met het oog op de beschikbare zorgcapaciteit. Ook moet deze aanpak leiden, aldus de premier, tot de opbouw van groepsimmuniteit.
Deze uitspraak heeft een storm van kritiek teweeg gebracht onder andere van buitenlandse experts. "Jaap van het RIVM" sprak daarop van "framing" en vond dat de kwestie van groepsimmuniteit werd opgeblazen.

Een patroon bij het RIVM. Gegeven adviezen worden even snel weer gebagatelliseerd of terzijde geschoven. Was het instituut recent nog niet van mening dat het virus niet heel besmettelijk leek en de kans klein was dat het zich hier zou verspreiden? En ook de scholen konden vorige week rustig open blijven. Van een kennis- en onderzoeksinstituut waar het landsbestuur in crisistijd op moet kunnen bouwen, mag beter worden verwacht...( in de stikstofcrisis klopten de metingen van het RIVM ook al niet en daarmee door de boeren geconfronteerd moest de woordvoerder eerst aan zijn baas toestemming vragen om iets te mogen zeggen ! )

Rutte liegt dat het echt onvoorstelbaar is
Hij heeft in zijn toespraak heel duidelijk uitgelegd wat groeps-immuniteit is, en wat de voordelen zijn, en dat dit de keuze is die het kabinet maakt. Hoe duidelijk wil je het hebben???
Leugen nr. 1
De dag erna ontkent hij glashard -vele malen- dat de groeps-immuniteit het doel is! Ook zegt hij dat de volledige lockdown zou betekenen dat het land 1 of 2 jaar op slot gaat.
Leugen nr. 2
Dat de mensen 2 jaar in hun huis moeten blijven. Dat zou dan de strategie van China zijn....!
In China is de lockdown al op de meeste plaatse opgeheven. Mensen gaan langzaam maar zeker weer aan het gewone leven beginnen

Dus twee ENORME leugens. Niet EEN kamerlid die hem corrigeert ! Zal de propaganda=pers het durven, morgen ? Tuurlijk niet!
Wilders doet goed het goed en begrijpt het. Hij pleit voor veel meer maatregelen. Baudet doet het goed, een van de weinigen die het begrijpt. Als je door een lockdown de besmetting enorm hebt teruggebracht, dan heb je daarna verplegers, IC's en mankracht genoeg om alle nieuwe zieken op te sporen en ál hun contacten in quarantaine te zetten.
Klaver kletst onzin. Klaver wil steeds 'staatsman achtig' over komen alsof hij premier is. Om te gieren als het niet zo triest was.

Seegers snapt we niks van: die denkt dat als je en lockdown hebt gehad, en als er daarna nog een enkeling het virus krijgt, dat dit betekent dat alle mensen toch weer besmettelijk zijn voor elkaar. Hij lijkt te denken dat een lockdown tijdelijk helpt. ( ca min 33)


Ik dacht niet dat Singapore een lockdown had. Ze hadden alleen enorm goede tests, controle en opsporing. En waren grif met quarantaines en boetes voor wie dacht nog wel even iets buiten te kunnen doen.

Wees verdorie transparant, speel geen spelletjes en realiseer je dat je door ons - de burgers - wordt betaald.

Aan de basis van deze politieke botsing ligt de visie van "Jaap van het RIVM en zijn jongens" dat het virus niet meer te stoppen is en een groot deel van de bevolking besmet zal raken.
We zagen minister Bruins onderuit gaan. Bezweken onder de druk. Geen minister van Volksgezondheid wil het risico lopen om duizenden over de kling te jagen voor een experiment. Deze man heeft gezondheid in zijn functie en niet de economische belangen van Rutte...!

Minister Bruins heeft zijn ontslag aan de Koning aangeboden.
Bijlagen:
Laatst bewerkt: 2 weken 4 dagen geleden door katertje.
De volgende gebruiker (s) zei dank u: [Guzzi], dirko

Please Inloggen to join the conversation.

Meer
2 weken 6 dagen geleden - 2 weken 6 dagen geleden #55987 door katertje
Een ruime Kamermeerderheid schaart zich dus achter de maatregelen van het kabinet om de verspreiding van Covid-19 tegen te gaan en de gevolgen voor de economie te verzachten.
De PVV wilde een lockdown, maar kreeg alleen steun van het FvD. De andere partijen vinden het niet verstandig het land op slot te doen.

Scholen en horeca zijn gesloten, mensen werken thuis, veel grote winkels sluiten hun deuren en er rijdt minder openbaar vervoer.Mensen binnenhouden tot er een medicijn of vaccin is, kan wel twee jaar duren, zei premier Rutte. Meer maatregelen zijn nu niet nodig, vindt hij. Met veel omhaal liet het kabinet weten dat zij haar aanpak van de Corona-crisis niet zou wijzigen. En de groepsimmuniteit dan? Nou dat standpunt werd handig aangepast, zoals we dat van Rutte gewend zijn....wij, het volk, heeft zich daar teveel op gefixeerd.
Het kabinet gaat door op de ingeslagen weg, al is die wellicht fataal De coalitiepartijen hebben voorstellen voor een koerswijziging afgewezen.. Misschien dat iets dergelijks in de toekomst nodig kan zijn. "Maar zover zijn we nog niet" Jesse Klaver is er nog niet klaar voor. Asscher, ofschoon veel nietszeggender zei hetzelfde. Brabbelt iets over dat "maximale beheersing nu het doel is en Nederland niet heel andere keuzes maakt dan andere landen"

Die rechtse drammers zouden eens gelijk kunnen krijgen over de risico’s van dat Corona-virus...!!
De oppositie laat vastleggen dat ze gewaarschuwd heeft, en dat als het fout loopt de consequenties voor het kabinet zijn.
Goed gedaan heren!

De overheid heeft, ondanks dat dit al maanden speelt, ook totaal geen voorbereidingen getroffen. Daardoor is er nu al een groot gebrek aan van alles wat nodig is om deze epidemie met minimale gevolgen te kunnen doorstaan.
Dat zal ook wel de hoofdreden van Rutte (en „Jaap en z’n jongens“ van het #RIVM) zijn geweest om voor “groepsimmuniteit” te gaan, omdat anders wel heel erg duidelijk wordt dat onze regenten niet enkel wat het quarantaine beleid betreft maar ook waar het de voorbereidingen betreft totaal gefaald hebben. Het beleid wordt door deze pluche klevers bepaald en komen er ook nu weer, mee weg.


BREAKING. Hoor net journalisten op @nproradio1 bepleiten het beleid van het kabinet m.b.t. het Coronavirus niet te bekritiseren. Dus we moeten dan maar blindelings vertrouwen en samen het ravijn in lopen? #coronavirusnl
Wat een stelletje lamzakken !!
Laatst bewerkt: 2 weken 6 dagen geleden door dirko.

Please Inloggen to join the conversation.

Meer
3 weken 7 uren geleden - 3 weken 6 uren geleden #55982 door katertje
De Tweede Kamer debatteert over de actuele ontwikkelingen rond het coronavirus. Premier Rutte en vier ministers leggen verantwoording af over de bestrijding en gevolgen van het virus. Het gaat om Bruno Bruins (Medische Zorg), Wopke Hoekstra (Financiën), Wouter Koolmees (Sociale Zaken) en Eric Wiebes (Economische Zaken).


Jaap van Dissel gaf woensdagochtend 18 maart in de Kamer uitleg over de strategie tegen corona. De directeur van het Centrum Infectieziektebestrijding moest vooral nuanceren en misverstanden uit de weg ruimen.

Maandagavond kreeg Mark Rutte nog complimenten voor zijn staatsmannelijke toespraak. Helder en gedecideerd bracht hij de boodschap dat Nederland door middel van maximale controle zou streven naar het afvlakken van de piek en het creëren van groepsimmuniteit tegen het coronavirus. Maar die nadruk op groepsimmuniteit keerde als een boemerang terug in het gezicht van de premier. En van de directeur van Centrum Infectieziekten bestrijding van het RIVM Jaap van Dissel. Nederland leek het enige land dat zo’n roekeloze strategie wilde volgen. Zowel de Wereldgezondheidsorganisatie WHO als verscheidene buiten- en binnenlandse experts uitten hun twijfels over het volledig inzetten op groepsimmuniteit.

Nadruk had niet zo op groepsimmuniteit moeten liggen
Woensdagochtend gaf Jaap van Dissel tijdens een uitlegsessie voor Kamerleden ruiterlijk toe dat het wellicht zijn schuld was dat de nadruk zo was komen te liggen op het opbouwen van groepsimmuniteit. Dat is geen doel, zei hij nu, maar een gunstig neveneffect van de aanpak die erop is gericht de piek in het aantal zieken af te vlakken en het aantal besmettingen uit te smeren over de tijd. Daar is geen lockdown voor nodig, zei Van Dissel, omdat je die niet kunt volhouden en omdat je na zo’n lockdown de boel weer openzet voor het virus terwijl nog bijna niemand immuniteit heeft opgebouwd.

Waarom niet testen, testen,testen?
Tegenstanders merken op dat er aan het gekozen scenario onzekerheden kleven. Bijvoorbeeld dat het nog niet vaststaat dat die immuniteit er is en ook van blijvende aard is. Van Dissel erkende dat, maar zei erbij dat de data uit China wel aanleiding geven om daar vanuit te gaan. Ook vrezen critici dat het soepele regime van social distancing zonder lockdown tot een explosieve stijging van het aantal besmetten en ernstig zieken zal leiden en dat er geen weg terug is, zodra het misgaat. Daarop zei Van Dissel dat voortdurend zal worden gemonitord hoeveel mensen het virus hebben gehad, zijn hersteld (als ze al klachten hadden) en of ze inderdaad immuun zijn.

De testen daarvoor zijn bijna beschikbaar
Over testen gesproken. Dat is wat de WHO als belangrijkste wapen ziet: testen, besmette mensen opsporen en isoleren. In Singapore en Zuid-Korea lijkt die aanpak goed te werken. Maar, zei Van Dissel, als we dat al zouden willen: landen als Singapore en Italië hebben alle testkits opgekocht. Er is simpelweg niet voldoende capaciteit om die strategie uit te voeren.
Communicatie blijkt cruciaal in deze crisis

Van Dissel sprak een paar keer van framing – een onterechte poging om de woorden van de premier en het RIVM nu anders te presenteren dan ze waren uitgesproken. Maar iedereen die de speech had gehoord, had één woord onthouden: groepsimmuniteit. Dus als dat niet de hoofdzaak was, dan lag dat aan de gekozen woorden, niet aan de oren van pers en publiek. Communicatie blijkt een cruciaal instrument tijdens deze crisis. Los van de woordkeuze bleef enige verwarring bestaan over de precieze koers van RIVM en kabinet.

In de soep
Geert Wilders zei ’s middags tijdens het debat in de plenaire zaal van de Tweede Kamer dat Nederland weer eens Gekke Henkie was, omdat geen enkel ander land het op deze manier doet. Hij, en Forum voor Democratie, willen per onmiddellijk een directe en totale lockdown. Door geen strengere maatregelen te nemen, maak je meer mensen ziek, betoogde PVV-leider Wilders. "Wij zullen nooit tekenen voor het bewust ziek maken van mensen, waardoor het helemaal in de soep loopt."


FvD-leider Baudet zei dat het kabinet moet zorgen dat mensen minder contactmomenten hebben. "Hoe eerder je dat doet, hoe minder slachtoffers je hebt." Andere partijen volgen de redenering van het kabinet dat het virus weer de kop opsteekt zodra de maatregelen worden versoepeld.
Coalitiepartijen wierpen in lijn met Van Dissel tegen dat Nederland niet zo ver afwijkt van de andere landen en dat vertrouwen in de deskundigheid van het RIVM nu geboden is. De vraag blijft of kabinet en RIVM bestand zijn tegen de druk van enkele partijen, andere landen, de WHO en de bevolking. Als de overtuiging breed gaat leven dat zij met een gevaarlijk experiment bezig zijn, zal het lastig zijn deze koers te blijven verdedigen, hoe goed die ook is onderbouwd. Het zal nog extra moeilijk worden als in de komende dagen het aantal besmettingen erg blijkt te stijgen. Dat kan bij elk scenario nog steeds het geval zijn, zonder dat er een direct oorzakelijk verband is, maar het zal eventuele twijfel over een strategie aanwakkeren.

> Blijkt dat de regering en het RIVM vanaf het begin achter de feiten heeft aangelopen, van "het komt niet naar Nederland" tot aan wie het wel of niet konden overdragen, zaten zij er naast. Is niet erg, het is ook een duivels gecompliceerd probleem en volkomen onbekend terrein. Alleen, dat lijkt nu opeens allemaal vergeten. Alsof Rutte en de zijnen het opeens helemaal bij het goede eind hebben terwijl daar toch werkelijk geen sprake van is. Kritiek mag al helemaal niet omdat, god verhoede, Wilders en Baudet met hun vroege alarmisme, misschien wel eens gelijk hadden? Dat nooit. Vandaar die kritiekloze steun van onze Linksmenschen en de media.

Wilders heeft in het verleden steeds bewezen dat hij de dingen op de juiste waarden kan schatten; en ook in dit geval zal het zo zijn.
Laatst bewerkt: 3 weken 6 uren geleden door katertje.

Please Inloggen to join the conversation.

Meer
3 weken 8 uren geleden #55981 door katertje
Wat is groepsimmuniteit en hoe werkt het? Telegraaf praat ons bij:

Groepsimmuniteit: wat is het en hoe bereiken we het?Bij de bestrijding van het nieuwe coronavirus is het van belang dat in Nederland gecontroleerd een „groepsimmuniteit” wordt opgebouwd. „Het virus is onder ons en zal voorlopig onder ons blijven”, zei premier Mark Rutte in zijn toespraak maandag. Wat houdt deze aanpak precies in?

Wat betekent groepsimmuniteit eigenlijk?
Mensen die met het virus besmet raken, bouwen antistoffen op en worden daardoor immuun. Hoe meer mensen immuun zijn, hoe minder mensen er ziek door worden, hoe minder de kans op verspreiding en hoe sneller een virus weer onderduikt of soms zelfs verdwijnt.

Hoe kun je groepsimmuniteit opbouwen?

Dat kan door de ziekte te krijgen of door mensen ertegen te vaccineren. In het vaccin zitten dan antistoffen waardoor het lichaam de ziekte weert. Maar voor Covid-19 is geen vaccin, dus op dit moment kan immuniteit opbouwen alleen nog door de ’natuurlijke’ manier van besmetting.

Waarom is gezegd dat 50 tot 60 procent van de bevolking de ziekte moet krijgen?

Dat is een aanname op basis van andere coronavirussen. Aangenomen wordt, dat als 50 tot 60 procent van de bevolking het heeft gehad, de immuniteit dusdanig groot dat het virus niet meer voor een uitbraak kan zorgen. Maar het percentage kan ook hoger of lager liggen voor een goede groepsbescherming. Want elk virus- of bacterieziekte heeft een eigen percentage. Voor mazelen, een van de meest besmettelijke ziektes ter wereld, moet zeker 90 procent van de bevolking immuun zijn. Voor mazelen bestaat een vaccin om die graad te kunnen bereiken.

Blijven die antistoffen voor altijd ons bloed, blijven we beschermd?

We weten niet hoe lang die antistoffen bij ons blijven. Het kan levenslang of tijdelijk zijn. Dat is ook afhankelijk van hoeveel antistoffen je hebt na besmetting. Dat wordt nu onderzocht in de Brabantse bevolking. Maar zeker is, op basis van de kennis en ervaring van andere coronavirussen, dat je bij elke infectie die zich epidemisch verspreidt groepsimmuniteit kunt opbouwen. Omdat we niet zeker weten of we beschermd blijven, wordt er hard gewerkt aan een vaccin.

d16906a4-688e-11ea-996d-02c309bc01c1

Hoe kan de ’sterke’ groep de zwakke groep beschermen?

Het nieuwe coronavirus lijkt op een brand. De Nederlandse bevolking bestaat uit een grote berg aanmaakhoutjes. Als je hierin één brandend houtje stopt – dat is de geïnfecteerde persoon – staat heel snel de hele berg in de brand en is iedereen tegelijkertijd ziek. Dat willen we niet, want dat kan ons zorgstelsel niet aan. Dus we zorgen dat een groot deel van de aanmaakhoutjes nat is; dat veel mensen het virus al hebben doorstaan. Als je bij die nattige houtjes een brandend aanmaakhoutje stopt, grijpt het vuur minder snel om zich heen. En ook mensen die het virus nog niet hebben doorgemaakt, mogen zich ertegen beschermd weten, zolang ze maar omringd worden door voldoende natte aanmaakhoutjes. De overheid wil de zwakkere groep (ouderen en mensen met chronische ziektes) beschermen door de rest van de bevolking -– 50 tot 60% – te laten fungeren als natte aanmaakhoutjes.

Dus enerzijds moeten we voorkomen dat we besmet raken en tegelijkertijd wil de overheid dat we immuniteit via besmetting juist opbouwen om verdere verspeiding van het virus te voorkomen. Is dat niet tegenstrijdig?

Het Nederlandse overheidsbeleid stoelt op de gedachte dat het virus nu eenmaal onder ons is en dat veel mensen zullen worden besmet. Door nu het aantal sociale contacten te verminderen, verloopt het besmettingsproces trager en wordt voorkomen dat de toestroom van patiënten te groot wordt voor ziekenhuizen. Zodra een corona-patiënt is opgeknapt, is er plaats voor iemand anders, en wordt immuniteit gecontroleerd opgebouwd. Dat is de theorie hierachter.

Kan je het nieuwe coronavirus meerdere keren krijgen?

Dat is wel de verwachting. Maar omdat er al antistoffen zijn opgebouwd, zal de ziekte die al voor 80 procent van de besmette personen mild verloopt, nog minder klachten geven.

Hoelang duurt het voor er met het gekozen scenario groepsimmuniteit is bereikt?

Dat is onbekend. Dit hebben we niet eerder meegemaakt. Het is afhankelijk van hoe het virus zich de komende tijd door Nederland gaat verspreiden. Als je alleen kijkt naar de groepsimmuniteit zou een snelle verspreiding van het virus misschien voordelig lijken. Maar met het oog op het zorgstelsel en de risico’s die een overbelasting daarvan met zich meebrengt, is het zaak het virus nu zoveel mogelijk af te remmen. Dat laatste betekent volgens Rutte, die zich baseert op de visie van deskundigen, dat groepsimmuniteit helaas nog maanden (of langer) op zich laat wachten.

Is er iets te zeggen over het aantal sterfgevallen in ons land door deze epidemie?

Dat is lastig, vinden deskundigen. We weten namelijk niet hoeveel mensen nu geïnfecteerd zijn. Het RIVM maakt dagelijks bekend hoeveel mensen eraan gestorven zijn of aan de gevolgen van het virus. De teller staat nu op 43. Op basis van de klinische gevallen weten we dat de sterfte nu op ongeveer 1% zit bij de besmette mensen. Maar experts vinden dat voor ons land aan de hoge kant en denken dat met de maatregelen dat percentage lager zal uitvallen omdat de ’sterke’ besmette groep de zwakke niet- besmette groep beschermt. Het hoeft dus helemaal niet te leiden tot duizenden doden.

Landen als Italië en Frankrijk nemen veel strengere maatregelen in de strijd tegen het virus. Een Italiaanse microbioloog verklaarde Nederland zelfs voor gek. Is onze aanpak niet te soft?

Ook in landen die nu zeer verregaande maatregelen nemen, is het virus niet verdwenen. Vroeg of laat duikt het daar weer op en een groot deel van de bevolking is nog vatbaar omdat er geen antistoffen zijn aangemaakt, zo zeggen experts. Het op slot gooien van een land is op de korte termijn misschien wel het beste, maar voor de lange termijn kan dat problemen opleveren. Landen maken een beslissing die gebaseerd is op de lokale omstandigheden, bijvoorbeeld de beschikbaarheid van ziekenhuiscapaciteit. Nederland heeft vooralsnog de faciliteiten en capaciteit, bezweren diverse deskundigen. Als er nieuwe gegevens beschikbaar komen in de loop van de epidemie kan het zijn dat er aanleiding is om maatregelen aan te passen.

Bronnen: RIVM, Scientias, virologen Ab Osterhaus en Eric van Gorp
De volgende gebruiker (s) zei dank u: [Guzzi], dirko

Please Inloggen to join the conversation.

Moderators: dirko